PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_025233-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 291aa    MW: 32264.3 Da    PI: 8.4181
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_025233-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.72.4e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+++++ +G g+W++ ++  g+ R++k+c++rw +yl
    NNU_025233-RA 14 KGAWTKEEDQRLINYIRTHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding59.95.7e-1967111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T+eEdel+++++ +lG++ W++Ia +++ gRt++++k++w+++
    NNU_025233-RA  67 RGNFTEEEDELIIKLHSLLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.2E-24564IPR009057Homeodomain-like
PROSITE profilePS5129416.759961IPR017930Myb domain
SuperFamilySSF466896.47E-3013108IPR009057Homeodomain-like
SMARTSM007177.4E-141363IPR001005SANT/Myb domain
PfamPF002497.8E-161461IPR001005SANT/Myb domain
CDDcd001672.11E-111661No hitNo description
PROSITE profilePS5129429.42762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-2865116IPR009057Homeodomain-like
SMARTSM007174.6E-1866114IPR001005SANT/Myb domain
PfamPF002493.8E-1767111IPR001005SANT/Myb domain
CDDcd001671.56E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0090378Biological Processseed trichome elongation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDQRLINYIR THGEGCWRSL PKAAGLLRCG KSCRLRWINY  60
LRPDLKRGNF TEEEDELIIK LHSLLGNKWS LIAGRLPGRT DNEIKNYWNT HIKRKLLSRG  120
LDPQTHRPLN SATNSSTTTP STTNTTNAYS DALNSSSPAA VLPEIVAINK TADKKGTTII  180
GANSAEEAHS SSGTTEEELL KHQPQQQQQE QNYPELNLEL SISLPSQSTP TANTAESKPQ  240
QFSIFAAPAP MIAQTICVCC RLGFQSSQNC NCQTTMITNG VHILQTSRFI D
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-301311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00053PBMTransfer from AT1G22640Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010246045.10.0PREDICTED: myb-related protein 330
SwissprotP813951e-103MYB30_ANTMA; Myb-related protein 330
TrEMBLA0A059BS021e-110A0A059BS02_EUCGR; Uncharacterized protein
STRINGVIT_07s0130g00040.t011e-107(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09460.18e-90myb domain protein 6